DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and march4l

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001038876.1 Gene:march4l / 100000640 ZFINID:ZDB-GENE-060825-323 Length:421 Species:Danio rerio


Alignment Length:145 Identity:43/145 - (29%)
Similarity:58/145 - (40%) Gaps:38/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INGLESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTASTAA------------------- 62
            :|.|.:.||||         |:|.|    |..:|:.|..|.....|                   
Zfish    58 MNELNAEGNAT---------SSATE----SHSLANGHYQPVTGEEALDTRGPDDWTHSVVDPPRT 109

  Fly    63 LEISSARQRMLRSHLQE--SLHSANESG---NSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCL 122
            |:..|:.:...:..|.|  ||:|..:||   ..||||.......|::. ||.|.|||...|..||
Zfish   110 LDCCSSSEDCSKEKLDERLSLNSCTDSGVRTPLCRICFQGPEQGELLS-PCRCSGSVRCTHEPCL 173

  Fly   123 KRWIMHRRDNRCEIC 137
            .:||..|....||:|
Zfish   174 IKWISERGSWSCELC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 20/47 (43%)
march4lNP_001038876.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..79 9/31 (29%)
RINGv 143..188 CDD:128983 19/45 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.