DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and ACTN3

DIOPT Version :10

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:NP_001245300.2 Gene:ACTN3 / 89 HGNCID:165 Length:944 Species:Homo sapiens


Alignment Length:123 Identity:48/123 - (39%)
Similarity:64/123 - (52%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  5060 LFKFTDPALNARAATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTT 5124
            :.:|....::....:.|:.||.||:.||..|.||.:.||.:||.||||.|||||...||..||..
Human   188 ILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAK 252

  Fly  5125 LTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFRNCQ 5182
            |.|.....|...||.||::...|..:||.||:|...:||.|.:..||...|..|...:
Human   253 LRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAE 310

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 PHA03247 <566..1191 CDD:223021
PTZ00449 <1035..1421 CDD:185628
PTZ00449 <1394..1702 CDD:185628
PTZ00121 <2080..2248 CDD:173412
Smoothelin 2594..2636 CDD:463614
Smoothelin 3127..3176 CDD:463614
Smc <3810..>3916 CDD:440809
PHA03247 <4126..4601 CDD:223021
CH_SMTN-like 5074..5179 CDD:409049 46/104 (44%)