DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and gpatch3

DIOPT Version :9

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:XP_005158511.1 Gene:gpatch3 / 791148 ZFINID:ZDB-GENE-070112-902 Length:688 Species:Danio rerio


Alignment Length:501 Identity:101/501 - (20%)
Similarity:172/501 - (34%) Gaps:143/501 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1994 CLLSIN-QKVDKFLR---------TAENVIRPTSLPSRPEIERPGLEEIDEELLRDDCTLSVSQK 2048
            |::|:. |:.|:|:|         ::.|.:|.|.|..|..:..           :.||.|     
Zfish    78 CVVSVRAQESDRFIRMYSGNQWIDSSGNWLRNTCLIRRVRVSE-----------QSDCDL----- 126

  Fly  2049 VHKFIDTAEKLAPTMPQKSPRLVANIERHISRQSEPERELDEESEPELDRDTDVEDDDQTSQLET 2113
                          .|.|:.   |.:.||:: |||...|.|....|||:....:...:..:.:..
Zfish   127 --------------FPYKTK---AELRRHVA-QSEQFTENDLRGLPELNPPALMPSGNVGTPVSV 173

  Fly  2114 EEEITQTVTKKETLKEFKQQTKETRETRRDSKAEPEKLQKKS---PQTKVKEESARVPKYQAKVS 2175
            ..::.|:                       .:..|..::|..   |:|........|| ||...:
Zfish   174 FLQLIQS-----------------------CRLPPRLIRKLGLTFPKTGSNRRYGNVP-YQYHNT 214

  Fly  2176 QKVSQWEPKKQPQREPKVTQKETPLEPKKQPLSKVKDEPEKVNKREPKVPQKESQTKLKEEPERV 2240
            :.|:       |..|...|.....::...|     :|.|...::::.|      .|.|..     
Zfish   215 RVVT-------PAEESVFTAGGVEIKGHAQ-----RDTPTTSHRKQGK------PTTLYR----- 256

  Fly  2241 TKKTPQKEPRKEPLRQSEDEPEFS--------PEEEFDDEPLPMTKTHTTAIEMKRQKDILNRPS 2297
            |::||.....|      :|.|..|        ..:...|.|....|...|....:|::|......
Zfish   257 TQETPTASQAK------QDTPTISLTIQDTPTTTQTNQDTPSTSCKIQDTPTASQRKQDTPTTSQ 315

  Fly  2298 VFGQRTPERKSSTTPSPTKLNGTRGRPSPSTNLITEEKRSYRNQVTNVSKPGTRKTTPSANSPAQ 2362
            .....|...|...||:.::    |.:.:|:|:.|.::                   ||:.:...|
Zfish   316 KLDMSTTSCKIQDTPTASQ----RKQDTPTTSCIIQD-------------------TPTTSQTVQ 357

  Fly  2363 SPPPKTTSISKRMEQISQQSWVVQDVDVDVEVVGPAPPS-HISEKP---QGKSPSPTSSRSLSRS 2423
            ..|  |||   :.:.:|..|..:||.....:.....|.| .|.:.|   |.|...|||. .:..:
Zfish   358 DTP--TTS---QKQDMSTTSCKIQDTPTASQRKDTPPTSCIIQDTPTASQRKDTPPTSC-IIQDT 416

  Fly  2424 PSRSPSRRTSTNLNTTSTNTTTTTEHPSTIKTTTPKPTSTNPSKDE 2469
            |:.|.::|.:|  .|.|.....|..:..|:...||.|....||::|
Zfish   417 PTTSQTKRLNT--PTASRKIQDTPTYTQTLYEDTPSPPVNQPSQEE 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981
gpatch3XP_005158511.1 RRM_SF 12..>31 CDD:302621
G_patch 585..631 CDD:197727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.