DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and si:ch211-195o20.7

DIOPT Version :9

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:XP_009291345.1 Gene:si:ch211-195o20.7 / 564006 ZFINID:ZDB-GENE-131127-614 Length:484 Species:Danio rerio


Alignment Length:368 Identity:91/368 - (24%)
Similarity:141/368 - (38%) Gaps:111/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  4854 KAQVSEKQRTVAA-----------YFSGQKSPTGGQVEELRTSMTTTTSSRKSAINRTKTSEKLS 4907
            :|:..|:..|:.|           ...|::. ..||:|.|||.:                 ||  
Zfish   183 RAEAEEELNTLRAARQDLGTQLADSLQGRRE-VEGQLESLRTEL-----------------EK-- 227

  Fly  4908 AAARKSLSSLTTTSNGNVSTAGLGMVVRGGGVGGIGGGAALSRSATMPHIANLNLLDESNVEDAF 4972
              :::.:..:..:..|..:..||...|.|.|             .:..||               
Zfish   228 --SKQKMKQVNGSHQGAATLRGLERRVEGSG-------------KSTGHI--------------- 262

  Fly  4973 EQLMMAQHKSSSSSEQRTETKSK-------------DGGATVTTTTTKVTT---RTVSGSAASKN 5021
            |||...:.|........||....             :|.:..:.|||..:|   :|.:||...:|
Zfish   263 EQLWTNEMKGKREISGNTERSRSLCRLPSDYTDAVVNGSSQPSITTTIESTPQSKTPAGSLDQQN 327

  Fly  5022 ISPLAKFKQLDKQAAAQQAQKSSPTTSTPTT----------------PGGSAQPLFKFTDPALNA 5070
                    .:......::.:.|.|.|.|.:.                |.|..         :|..
Zfish   328 --------NMTNSIKDKKVENSLPQTGTSSVLDVTNKVSRMRMQEDFPSGLR---------SLRL 375

  Fly  5071 RAATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFE 5135
            ...:.::.||:||:.:||.|:|::|.||||.|.|||||||:.|.:||....|..|:.:.::.|..
Zfish   376 HGGSRRNSLLRWCQCRTQGYKNIEITNFSSCWVDGLAFCAIYHSYLPSHIPYNRLSPENKKENLT 440

  Fly  5136 LAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRF 5178
            |||... |..||:..|.||:|::...|||..|..||:||||.|
Zfish   441 LAFQTG-EGFGISTSLTVEEMLKDDAPDWHRVLEYVESIYRHF 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981 48/103 (47%)
si:ch211-195o20.7XP_009291345.1 SPEC 143..>289 CDD:295325 27/155 (17%)
CH 379..482 CDD:237981 47/103 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4678
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.