DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and Actn3

DIOPT Version :9

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:NP_524801.1 Gene:Actn3 / 44964 FlyBaseID:FBgn0015008 Length:553 Species:Drosophila melanogaster


Alignment Length:521 Identity:97/521 - (18%)
Similarity:178/521 - (34%) Gaps:140/521 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  4716 NSTTTSSTSVRSTTVVQ------QQHHQQQHQQIKPSIVETPATPQPQVPPEDEIPHNIVFNNVS 4774
            :|.||:.|.|:.:.:.:      ...::::.|::                  :.:.||::.....
  Fly   100 SSCTTTETLVKESPICELNKLRLMLKNEKKKQEL------------------EIMGHNLIIMKEK 146

  Fly  4775 AFTSMSRRNHEEDSHQGTQSGSRVNRLSKC---------DSWNQICQLQQTAGPSPAKYNQPGSP 4830
            .....:|:|.....::..:...|:..|.:|         :...|..:|::.:.....:.||    
  Fly   147 TLVLQARKNQRAAENRLAEKQDRIKALEECLANCKFQLKNVNEQYQKLKKASNQLIRESNQ---- 207

  Fly  4831 GELRRTKSGHSLAVPKLYEAGIDKAQVSEKQRTVAAYFSGQKSPTGGQVE-ELRTSMTTTTSSRK 4894
              :|..||...|       .|..|.::|.:...|      .||....|.| |....:....|..|
  Fly   208 --IRPQKSWSVL-------VGRRKGRISTRTSFV------WKSLKLDQSERETLMGLKKRLSEEK 257

  Fly  4895 SAINRTKTSEKLSAAARKSLSSLTTTSNGNVSTAGLGMVVRGGGVGGIGGGAALSRSATMPHIAN 4959
            ....|.||.   .:..||::..|..                  |.|.:..|              
  Fly   258 EIKLRAKTE---MSKIRKAMDELCL------------------GKGELQFG-------------- 287

  Fly  4960 LNLLDESNVEDAFEQLMMAQHKSSSSSEQRTETKSKD-------------GGATV--------TT 5003
               |...:..||.:..::...|:.|:..|....|..|             |..|.        .:
  Fly   288 ---LQNKSETDASKDTLVVIDKALSALSQYNTLKFPDCNFQLSRLMKSLYGSLTTIRDRWIRKIS 349

  Fly  5004 TTTKVTTRTVSGSAASKNISPLAKFKQLDK-----QAAAQQAQKSSPTTS-TPTTPGGSAQPLFK 5062
            :..:.|...:..:..|....||......|.     .....|:....|.|| .|..|....:.|..
  Fly   350 SAVEPTPSCLKSNTPSLPEPPLTVSFSTDLFWDKIYKPCTQSNPVMPNTSLIPVLPKKQPKSLQL 414

  Fly  5063 FTDPALNARAA---------------TVKDQ---LLQWCKHKTQEYENVQINNFSSSWSDGLAFC 5109
            ..:|::..:.|               |..|:   ||:||:.:.:.| .:.:..||:||..|.|.|
  Fly   415 TCEPSVQYKVASRSSTTAPVPKYLGKTFGDRRLSLLRWCQERVKPY-GIPMYEFSASWISGRALC 478

  Fly  5110 ALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKA-GIAPLLDVEDMVEMSRPDWKCVFVYVQS 5173
            |:||.:|||..|.|.|.|  ::....||:.:...|: |::..:|:...:...||:.:.:..:|:.
  Fly   479 AIIHSYLPDLIDKTYLAK--KKPEEVLAYGIKVAKSIGVSDSVDLIRELRQGRPNLEKIVDFVEE 541

  Fly  5174 I 5174
            :
  Fly   542 L 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981 31/103 (30%)
Actn3NP_524801.1 CH 449..546 CDD:237981 30/97 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4678
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.