DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and Dtg

DIOPT Version :9

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster


Alignment Length:568 Identity:129/568 - (22%)
Similarity:219/568 - (38%) Gaps:133/568 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1808 MSSLKPGGDRSRPSKCCTTKTINL-----------------SEQRINTAT------DIEG-VIID 1848
            |:|:    .:||.|.|.:.|.::|                 |.|.|.:.:      |:|| .|:.
  Fly     1 MASI----SKSRASSCSSRKRLHLQPGSLLCVIVFCLLASCSAQPIESTSLPAEVDDVEGTTILP 61

  Fly  1849 IQQAKSSREPSPDRIV----PTPVP-AELETGKPRYPDVVQEPDD---------EPRRKPQVTN- 1898
            ||..:||  |:|:.|:    .|.:| .||:..:....|.|:..|:         |...|..|.: 
  Fly    62 IQLEESS--PTPEPIIKNETATALPVVELKVAESNPVDPVEATDNFVSVYGGNLEQDIKNDVNSE 124

  Fly  1899 --------IPIFEEESQTYVGCQISELHSSNGIEVDILDNPTVEAPKSLDYPVNTPDTDESLLSV 1955
                    .||.||..      :::|....|. |:.:......| |||||....:...||..|..
  Fly   125 VEDAPSPVEPIIEEVQ------KVAEAELENH-EIKLAVQSARE-PKSLDAEEESKTIDEDRLEN 181

  Fly  1956 HEKVSRFTHSAEKVKEPKVSAPFSREFDVNAK-IPENDDCLLSINQKVDKFLRTAENVIRPTSLP 2019
            .:|....|.:.         |..|.:.:.:.: :|.....|:|:....||.:  .|..|..|:|.
  Fly   182 QDKAETVTDNI---------AVSSEQMESHIRPLPNVTSDLVSVILNEDKAI--TEQPITKTNLL 235

  Fly  2020 SRPEIERPGLEEIDEELLRDDCTLSVSQKVHKFIDTAEKLAPTMPQKSPRLVANIERHISRQSEP 2084
            :. |.|....|||||     ..|:.|.::....:...:.:......:.|..|:: |:|.....||
  Fly   236 AL-EQEHEKFEEIDE-----STTVPVYEEPKHQVTKKQGVEDPSTVEIPPEVSD-EQHFDPSEEP 293

  Fly  2085 ERELDEESEPELDRDTDVEDDDQT----SQLETEEEITQTVTKK---ETLKEFKQQTKETRETRR 2142
            :...||       |:.:..||:|.    :.:|.||...:|.|..   .|::..|..|:...|.  
  Fly   294 QTVRDE-------RNLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPTKSITEPNEEI-- 349

  Fly  2143 DSKAEPEKLQKKSPQTKVKEESARVPKYQAKVSQKVSQWEPKKQPQREPKVTQKETPLEPKKQPL 2207
            :.|||.|...:...|.:|...|         |...|...:|   .:.:.:|...||.:|      
  Fly   350 EKKAEAEAKAEMEEQVEVNTPS---------VDATVVAADP---DEAQDEVIVAETTVE------ 396

  Fly  2208 SKVKDEPEKVNKREPKVPQKESQTKLKEE-PERVTKKTPQKEPRKEPLRQ------SEDEPEFSP 2265
             .:.:..:.|.:.|||......|..|||: .:.|::...|..|.:||:::      .::.|....
  Fly   397 -AITEAAKIVVEEEPKEDVSVQQEHLKEQRVQTVSESNRQASPTEEPIKEVIFPKGDDESPVEGD 460

  Fly  2266 EEEFDDEPLPMTKTHTTAIEMKRQKDILNRPSVFGQRTPERKSSTTPS 2313
            ..|.|::|.........:.| ::.:|:::          |.|||:..|
  Fly   461 SSESDEKPTERAIVDDDSSE-EQNEDVVD----------EGKSSSDDS 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 56/245 (23%)
rne <303..445 CDD:236766 39/162 (24%)
DUF3295 <410..>498 CDD:288540 22/99 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.