DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and IBSP

DIOPT Version :9

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:312 Identity:69/312 - (22%)
Similarity:99/312 - (31%) Gaps:93/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1422 PKKGQSPVQFKTEETPRYPQEQERYPKEPETSQYPKESPR-NPKEDAETININEETTIVITKEGS 1485
            |.:|.|.   .:||......|:|.  :|.|||...:.:.. |..||:|.    |.||:..|..|.
Human    59 PVQGSSD---SSEENGDDSSEEEE--EEEETSNEGENNEESNEDEDSEA----ENTTLSATTLGY 114

  Fly  1486 KSPSPRWSPSPERRVPKSQQPPSPTASPSVSPVSGRKIPNEVESNFVTEKIIDCRGKTVVEKISQ 1550
                                  ...|:|..                         |.|.:..| |
Human   115 ----------------------GEDATPGT-------------------------GYTGLAAI-Q 131

  Fly  1551 RPRTPSPTTPKKNTKPSQKIPERVPETESEPEKDSESETKKT----TSVSVTKTETERRNSRTTK 1611
            .|:.....| .|.||..:...|...|.|....::||:|..:.    ...|...||.|..|.    
Human   132 LPKKAGDIT-NKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNG---- 191

  Fly  1612 TKQPLPLKEPQSKVPAGKSPRKDSLTGRKRDSLVEETRITTTTTTTRQGRKPSDTNGSPSIKDRL 1676
                      .|....|:...::|:||...:.         ||.|.|||:..|.|..||      
Human   192 ----------SSGGDNGEEGEEESVTGANAED---------TTETGRQGKGTSKTTTSP------ 231

  Fly  1677 RSSPRKQKTSPQQTRTPTPAQTRNPEDDVDGDSSSPDASPTRVGNERRRSSN 1728
             :...:..|.||..||.:|...:....:.:|:.....|:....|.|...|.|
Human   232 -NGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESEN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 69/312 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 63/282 (22%)
cell-attachment tripeptide 286..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.