DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and Smtn

DIOPT Version :10

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:XP_006514787.1 Gene:Smtn / 29856 MGIID:1354727 Length:954 Species:Mus musculus


Alignment Length:120 Identity:22/120 - (18%)
Similarity:46/120 - (38%) Gaps:39/120 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSRSSRAGLQFPVGRLHRILR-----KGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNK 76
            ::...||.|:..||:|...|:     :..||:.:...:.::...| :.:|.:|     :|.::.|
Mouse   281 QAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRV-QQMAEQV-----HALKEEK 339

  Fly    77 KTR---------------------------IAPRHLQLAVRND-EELNKLLAGVT 103
            :.|                           ..|...:..::.: |:|.|.|.|:|
Mouse   340 EQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 PHA03247 <566..1191 CDD:223021
PTZ00449 <1035..1421 CDD:185628
PTZ00449 <1394..1702 CDD:185628
PTZ00121 <2080..2248 CDD:173412
Smoothelin 2594..2636 CDD:463614
Smoothelin 3127..3176 CDD:463614
Smc <3810..>3916 CDD:440809
PHA03247 <4126..4601 CDD:223021
CH_SMTN-like 5074..5179 CDD:409049
SmtnXP_006514787.1 Smoothelin 1..34 CDD:463614
Smoothelin 73..122 CDD:463614
PHA03247 <107..454 CDD:223021 22/120 (18%)
Smoothelin 601..648 CDD:463614
CH_SMTNA 837..947 CDD:409107
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.