DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34417 and smtna

DIOPT Version :9

Sequence 1:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster
Sequence 2:XP_003199343.1 Gene:smtna / 100333230 ZFINID:ZDB-GENE-091204-245 Length:271 Species:Danio rerio


Alignment Length:237 Identity:85/237 - (35%)
Similarity:117/237 - (49%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  4961 NLLDESNVEDAFEQLMMAQHKSSSSSEQRTETKSKDGGATVTTTTTKVTTRTVSGSAASKNISPL 5025
            |:||:: |:  ||:..|.:.......:::.|.:.::..|.:.      ..|..:|...|.::|..
Zfish    38 NMLDKA-VD--FEERKMIRAAMRELLKRKRERRDRERAARME------NLRQGTGGKTSASLSKD 93

  Fly  5026 AKFK------QLDKQAAAQQAQKSSPTT-STPTT--------------PGGSAQPLFKFTDPALN 5069
            .|..      |.:....||....|.||: |:|.|              .||||         ...
Zfish    94 QKASNGPGGAQFNAHRTAQAKTLSQPTSVSSPKTVSSPAQSHVARVKMSGGSA---------VGG 149

  Fly  5070 ARAATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNF 5134
            .....||..||.||:.||:.||.|.|.||||||:||||||||:|.|.|:.|:|.||....|:.||
Zfish   150 PNTKDVKQMLLDWCRVKTEPYEGVNIQNFSSSWADGLAFCALVHRFFPEGFEYCTLNPYDRKSNF 214

  Fly  5135 ELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYR 5176
            |.||..|:..|...|||||:|::.|..||||||:.|:|..||
Zfish   215 EKAFKTAERLADCPPLLDVDDLMRMREPDWKCVYTYIQEFYR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981 57/101 (56%)
smtnaXP_003199343.1 Smoothelin 20..59 CDD:315226 7/23 (30%)
CH 153..256 CDD:306753 56/102 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4521
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001328
OrthoInspector 1 1.000 - - otm25181
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.