DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dx and si:dkey-3h3.3

DIOPT Version :9

Sequence 1:NP_511064.2 Gene:dx / 31589 FlyBaseID:FBgn0000524 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001116534.1 Gene:si:dkey-3h3.3 / 100144568 ZFINID:ZDB-GENE-060526-299 Length:441 Species:Danio rerio


Alignment Length:465 Identity:117/465 - (25%)
Similarity:180/465 - (38%) Gaps:132/465 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 HAHFSHAKNMLTASMNSHHSRCSE--------GSLQS-----------QRSSRMGSHRSRSRTRT 409
            |.......|.:|:.:|....|.::        |..|.           |.:.....|..:.....
Zfish    16 HPAIFQPPNSVTSILNGKTIRVTQKEDYLIATGKFQDIKDFYKSCIKIQTTHNRPKHPKQQEMSM 80

  Fly   410 SDTDTNSVKSHRRRPSV-------DTVSTYLSHESK---ESLRSRNFAISVNDLLDCSLGSDEVF 464
            |...|.|..|.:..|||       |||..|:..:..   |:::.|: .:|:|     :..:...|
Zfish    81 SSHTTASPGSAQNDPSVFDPIKVDDTVMQYIKEKKSKEFEAIQKRH-GVSIN-----TFKNYLTF 139

  Fly   465 VPSLPPSSLGERAPVPPPLPLHPRQQQQQ-----QQQQQQLQMQQQQQ----------------- 507
            .|....:             :|.:..:::     |:....||::....                 
Zfish   140 TPQTGKN-------------IHAQFAREEFITLYQKIAIGLQIRNHNYRRDIFEFCSSEFPELLI 191

  Fly   508 --AQQQQQQSIAGSIVGVDPASDMISRFVKVVEPPLW------------------PNAQP----- 547
              :..::|..:.|..:.::       ||...::...|                  |..||     
Zfish   192 NLSSDRKQMQLIGDFISLE-------RFDTCLKGSDWRRYSLHQTPSRTMTHYDTPRTQPAKHEK 249

  Fly   548 ---------CPMCMEELVHSAQNPAISLSRCQHLMHLQCLNGMIIAQQNEMNKNLFIECPVCGIV 603
                     ||:|:|.:   ....:..|::|||.....||:...         .|...||:||.:
Zfish   250 TSDQAKDETCPICLETI---KMPESTVLTKCQHRFCKDCLDTAF---------QLKPACPICGEI 302

  Fly   604 YGEKVGNQPI-GSMSWSIISKNLPGHEGQNTIQIVYDIASGLQTEEHPHPGRAFFAVGFPRICYL 667
            ||...|.||. |:|:.|.....|||::|..||.|.|.|.||.|..|||:||..:.  |..||.||
Zfish   303 YGSLTGTQPKGGTMTVSRDRSCLPGYKGYGTIVITYYIPSGSQGVEHPNPGMPYH--GASRIAYL 365

  Fly   668 PDCPLGRKVLRFLKIAFDRRLLFSIGRSVTTGREDVVIWNSVDHKTQFN------MFPDPTYLQR 726
            ||...|..||:.|:.|||:||.|:||||.|||:.:||.||.:.|||..:      .:|||.||:|
Zfish   366 PDSTEGTHVLKLLQRAFDQRLTFTIGRSSTTGKNNVVTWNDIHHKTSRDGGPTHYGYPDPDYLKR 430

  Fly   727 TMQQLVHLGV 736
            ...:|...|:
Zfish   431 VQDELKAKGI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dxNP_511064.2 WWE 47..126 CDD:128922
WWE 133..209 CDD:128922
RING 548..600 CDD:238093 13/51 (25%)
Deltex_C 609..735 CDD:193607 61/132 (46%)
si:dkey-3h3.3NP_001116534.1 zf-RING_2 257..299 CDD:290367 13/53 (25%)
Deltex_C 308..439 CDD:193607 61/132 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.