DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and DOCK4

DIOPT Version :10

Sequence 1:NP_511063.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_016868308.1 Gene:DOCK4 / 9732 HGNCID:19192 Length:2006 Species:Homo sapiens


Alignment Length:133 Identity:28/133 - (21%)
Similarity:41/133 - (30%) Gaps:50/133 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQK 77
            |.::.||.|:.|..||                                  |.|    ..:..::|
Human  1909 VNEQSAPLPVPVPVPV----------------------------------PSY----GGEEPVRK 1935

  Fly    78 RLKVPPPIHQFSQTLDKTTAVKLFKLLE-------KYRPESPLAKKLRLKKIAEAKAKGKDVEPK 135
            ..|.|||...:.:||.:  .|.|...|.       ...|..|||.:   ....|..|:..|..|:
Human  1936 ESKTPPPYSVYERTLRR--PVPLPHSLSIPVTSEPPALPPKPLAAR---SSHLENGARRTDPGPR 1995

  Fly   136 KKP 138
            .:|
Human  1996 PRP 1998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_511063.1 SNU13 18..271 CDD:455736 27/128 (21%)
DOCK4XP_016868308.1 SH3_DOCK4_B 44..96 CDD:212982
DOCK_N 104..423 CDD:465040
C2_Dock-B 431..615 CDD:176077
DHR2_DOCK4 1237..1627 CDD:212578
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.