DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and AT3G62870

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_191846.1 Gene:AT3G62870 / 825462 AraportID:AT3G62870 Length:256 Species:Arabidopsis thaliana


Alignment Length:262 Identity:158/262 - (60%)
Similarity:194/262 - (74%) Gaps:10/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQK 72
            |||   ..|||    :.|||  :||.|.|||:|||.||||..:.||:||||:::|||.||:||||
plant     3 PKK---GVKVA----SKKKP--EKVTNPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQK 58

  Fly    73 AVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKK 137
            .:|::||||||.::||::||||..|..|||:|.|||||...|||.||...|:|:|:||..| .||
plant    59 RILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEDKAAKKERLLNKAQAEAEGKPAE-SKK 122

  Fly   138 PSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRK 202
            |..|..|.|.||.||||.|||||||||||||:|||::||||||||.|||||||||:|||.:|.:|
plant   123 PIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLGAVVHQK 187

  Fly   203 TCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELA 267
            |...|.||||.|.||..|.|:|||:|.|||:::||.|:.|||||:||||.|:....||..|:|.|
plant   188 TAAALCLTTVKNEDKLEFSKILEAIKANFNDKYEEYRKKWGGGIMGSKSQAKTKAKERVIAKEAA 252

  Fly   268 QK 269
            |:
plant   253 QR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 153/252 (61%)
Ribosomal_L7Ae 37..257 CDD:294400 139/219 (63%)
AT3G62870NP_191846.1 PTZ00365 8..255 CDD:240382 155/254 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1718
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H135416
Inparanoid 1 1.050 304 1.000 Inparanoid score I770
OMA 1 1.010 - - QHG54180
OrthoDB 1 1.010 - - D1200503at2759
OrthoFinder 1 1.000 - - FOG0000860
OrthoInspector 1 1.000 - - otm2701
orthoMCL 1 0.900 - - OOG6_101259
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X505
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.