DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and AT2G47610

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_182283.1 Gene:AT2G47610 / 819374 AraportID:AT2G47610 Length:257 Species:Arabidopsis thaliana


Alignment Length:262 Identity:156/262 - (59%)
Similarity:193/262 - (73%) Gaps:9/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQK 72
            |||        ...:|.||...:||.|.|||:|||.||||..:.||:||||:::|||.||:||||
plant     3 PKK--------GVKVAAKKKTAEKVSNPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQK 59

  Fly    73 AVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKK 137
            .:|::||||||.::||::||||..|..|||:|.|||||...|||.||.|.|:|:|:||..| .||
plant    60 RILKQRLKVPPALNQFTKTLDKNLATSLFKVLLKYRPEDKAAKKERLVKKAQAEAEGKPSE-SKK 123

  Fly   138 PSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRK 202
            |..|..|.|.||.||||.|||||||||||||:|||::||||||||.|||||||||:|||.:|.:|
plant   124 PIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLGAVVHQK 188

  Fly   203 TCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELA 267
            |.:.|.||||.|.||..|.|:|||:|.|||:::||.|:.|||||:||||.|:....||..|:|.|
plant   189 TASCLCLTTVKNEDKLEFSKILEAIKANFNDKYEEYRKKWGGGIMGSKSQAKTKAKERVIAKEAA 253

  Fly   268 QK 269
            |:
plant   254 QR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 153/252 (61%)
Ribosomal_L7Ae 37..257 CDD:294400 140/219 (64%)
AT2G47610NP_182283.1 Ribosomal_L7Ae 24..256 CDD:294400 146/233 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1718
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H135416
Inparanoid 1 1.050 304 1.000 Inparanoid score I770
OMA 1 1.010 - - QHG54180
OrthoDB 1 1.010 - - D1200503at2759
OrthoFinder 1 1.000 - - FOG0000860
OrthoInspector 1 1.000 - - otm2701
orthoMCL 1 0.900 - - OOG6_101259
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X505
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.