DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and zgc:153325

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001038872.1 Gene:zgc:153325 / 751694 ZFINID:ZDB-GENE-060825-305 Length:269 Species:Danio rerio


Alignment Length:270 Identity:186/270 - (68%)
Similarity:228/270 - (84%) Gaps:3/270 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKY 65
            ||:||   .||.|.|||||.|||.:|.|.|||.|.|||||||||||||::|||||||||||||||
Zfish     1 MVIKK---GKKKVGKKVAPPPLATRKEVTKKVENPLFEKRPKNFGIGQDIQPKRDLSRFVRWPKY 62

  Fly    66 IRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGK 130
            ||:|||:::|||||:||||||:|..|||:.|||::||||:||:|||..||:.||:..|||||.||
Zfish    63 IRLQRQESILQKRLEVPPPIHRFKSTLDRQTAVQMFKLLDKYKPESKQAKRQRLRAQAEAKAAGK 127

  Fly   131 DVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARL 195
            :|...|:|:.|..|.|.||:|:||||||||||||||:|:|||:|||:|||||||||||||.|:||
Zfish   128 EVPVTKRPAVVRQGINDVTRLVEQKKAQLVVIAHDVNPVELVIFLPSLCRKMGVPYCIVKDKSRL 192

  Fly   196 GRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLER 260
            |||||||||:.:|||.|:..|:....|::|.||||:|:|.|||::|||||.|||||.|||:|:|:
Zfish   193 GRLVRRKTCSAVALTQVEAGDRNALAKLIETVKTNYNDRFEEIKKHWGGGTLGSKSNARIAKIEK 257

  Fly   261 AKARELAQKQ 270
            |||:|:||||
Zfish   258 AKAKEMAQKQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 176/253 (70%)
Ribosomal_L7Ae 37..257 CDD:294400 154/219 (70%)
zgc:153325NP_001038872.1 PTZ00365 15..266 CDD:240382 173/250 (69%)
Ribosomal_L7Ae 34..254 CDD:294400 154/219 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.