DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and Rsrc1

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001343202.1 Gene:Rsrc1 / 66880 MGIID:1914130 Length:338 Species:Mus musculus


Alignment Length:116 Identity:30/116 - (25%)
Similarity:52/116 - (44%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KRDLSRFVRWPKYIRVQRQKAVLQ-KRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKK 116
            ||..||.....|..||||.::..: :|.:..|.....|::.::::..:     .:.|......:|
Mouse    85 KRSRSRSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRR-----TRSRSRDRDRRK 144

  Fly   117 LRLK-KIAEAKAKGKDVE----PKKKPSYVSAGTNTVTKLIEQKKAQLVVI 162
            :|.| |..:.|.||||.|    .:.....:.||...:.. .||.||:|.::
Mouse   145 VRDKEKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPP-AEQAKARLQLV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 30/116 (26%)
Ribosomal_L7Ae 37..257 CDD:294400 30/116 (26%)
Rsrc1NP_001343202.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.