DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and RPS12

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001007.2 Gene:RPS12 / 6206 HGNCID:10385 Length:132 Species:Homo sapiens


Alignment Length:98 Identity:21/98 - (21%)
Similarity:38/98 - (38%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCT 205
            ::.|.....|.:::::|.|.|:|.:.|....|..:.|||.:..:....|....:||..|      
Human    31 LARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWV------ 89

  Fly   206 TLALTTVDNNDK------------ANFGKVLEA 226
              .|..:|...|            .::||..:|
Human    90 --GLCKIDREGKPRKVVGCSCVVVKDYGKESQA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 21/98 (21%)
Ribosomal_L7Ae 37..257 CDD:294400 21/98 (21%)
RPS12NP_001007.2 Ribosomal_L7Ae 16..111 CDD:396000 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.