powered by:
Protein Alignment RpL7A and RPS12
DIOPT Version :9
Sequence 1: | NP_001284944.1 |
Gene: | RpL7A / 31588 |
FlyBaseID: | FBgn0014026 |
Length: | 271 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001007.2 |
Gene: | RPS12 / 6206 |
HGNCID: | 10385 |
Length: | 132 |
Species: | Homo sapiens |
Alignment Length: | 98 |
Identity: | 21/98 - (21%) |
Similarity: | 38/98 - (38%) |
Gaps: | 20/98 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 VSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCT 205
::.|.....|.:::::|.|.|:|.:.|....|..:.|||.:..:....|....:||..|
Human 31 LARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWV------ 89
Fly 206 TLALTTVDNNDK------------ANFGKVLEA 226
.|..:|...| .::||..:|
Human 90 --GLCKIDREGKPRKVVGCSCVVVKDYGKESQA 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.