DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and RPL7A

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_000963.1 Gene:RPL7A / 6130 HGNCID:10364 Length:266 Species:Homo sapiens


Alignment Length:265 Identity:181/265 - (68%)
Similarity:216/265 - (81%) Gaps:1/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PK-KKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQ 71
            || ||...|||||||..|||...|||||.|||||||||||||::||||||:|||:||:|||:|||
Human     2 PKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQ 66

  Fly    72 KAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKK 136
            :|:|.|||||||.|:||:|.||:.||.:|.||..|||||:...||.||...||.||.||...|.|
Human    67 RAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTK 131

  Fly   137 KPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRR 201
            :|..:.||.||||.|:|.||||||||||||||:|||:|||||||||||||||:||||||||||.|
Human   132 RPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHR 196

  Fly   202 KTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKAREL 266
            |||||:|.|.|::.||....|::||::||:|:|::||||||||.:||.||:|||:|||:|||:||
Human   197 KTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKEL 261

  Fly   267 AQKQG 271
            |.|.|
Human   262 ATKLG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 173/252 (69%)
Ribosomal_L7Ae 37..257 CDD:294400 150/219 (68%)
RPL7ANP_000963.1 PTZ00365 16..266 CDD:240382 170/249 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143378
Domainoid 1 1.000 166 1.000 Domainoid score I3895
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 367 1.000 Inparanoid score I2158
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54180
OrthoDB 1 1.010 - - D1200503at2759
OrthoFinder 1 1.000 - - FOG0000860
OrthoInspector 1 1.000 - - oto88978
orthoMCL 1 0.900 - - OOG6_101259
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1145
SonicParanoid 1 1.000 - - X505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.