DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and SNU13

DIOPT Version :10

Sequence 1:NP_511063.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_004999.1 Gene:SNU13 / 4809 HGNCID:7819 Length:128 Species:Homo sapiens


Alignment Length:86 Identity:29/86 - (33%)
Similarity:45/86 - (52%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLP 176
            |||.....||:.:...:..:.:..:|      |.|..||.:.:..::.:|:|.|.:|||::|.||
Human    12 PLADAHLTKKLLDLVQQSCNYKQLRK------GANEATKTLNRGISEFIVMAADAEPLEIILHLP 70

  Fly   177 ALCRKMGVPYCIVKGKARLGR 197
            .||....|||..|:.|..|||
Human    71 LLCEDKNVPYVFVRSKQALGR 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_511063.1 SNU13 18..271 CDD:455736 29/86 (34%)
SNU13NP_004999.1 SNU13 7..128 CDD:411046 29/86 (34%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000269|PubMed:17412961, ECO:0000269|PubMed:21784869 36..48 5/17 (29%)
Important for U4 snRNA-binding. /evidence=ECO:0000269|PubMed:10545122 96..128
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.