DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and rpl7a

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001072159.1 Gene:rpl7a / 447981 XenbaseID:XB-GENE-959321 Length:266 Species:Xenopus tropicalis


Alignment Length:265 Identity:188/265 - (70%)
Similarity:217/265 - (81%) Gaps:1/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PK-KKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQ 71
            || ||...|||||||..|||...|||||.|||||||||||||::||||||:|||:||:|||:|||
 Frog     2 PKGKKAKGKKVAPAPSVVKKAEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQ 66

  Fly    72 KAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKK 136
            ||:|.|||||||.|:||:|.||:.||.:||||..|||||:...||.||...||.||.||...|.|
 Frog    67 KAILYKRLKVPPAINQFTQALDRQTATQLFKLAHKYRPETKQEKKKRLLARAEQKAAGKGDVPTK 131

  Fly   137 KPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRR 201
            :|..:.||.||||.|:|.||||||||||||||:|||:||||||||||||||||||||||||||.|
 Frog   132 RPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIVKGKARLGRLVHR 196

  Fly   202 KTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKAREL 266
            ||||::|||.|:..||....|::||||||:|:|.:||||||||||||.||:|||:|||:|||:||
 Frog   197 KTCTSVALTQVNPEDKGALAKLVEAVKTNYNDRFDEIRRHWGGGILGPKSVARIAKLEKAKAKEL 261

  Fly   267 AQKQG 271
            |.|.|
 Frog   262 ATKLG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 180/252 (71%)
Ribosomal_L7Ae 37..257 CDD:294400 157/219 (72%)
rpl7aNP_001072159.1 PTZ00365 16..266 CDD:240382 177/249 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 169 1.000 Domainoid score I3765
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H135416
Inparanoid 1 1.050 373 1.000 Inparanoid score I2067
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1200503at2759
OrthoFinder 1 1.000 - - FOG0000860
OrthoInspector 1 1.000 - - oto102844
Panther 1 1.100 - - LDO PTHR23105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.