DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and snu13

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_988994.1 Gene:snu13 / 394590 XenbaseID:XB-GENE-963821 Length:128 Species:Xenopus tropicalis


Alignment Length:86 Identity:29/86 - (33%)
Similarity:44/86 - (51%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLP 176
            |||.....|.:.:...:..:.:..:|      |.|..||.:.:..|:.:|:|.|.:|||::|.||
 Frog    12 PLADAQLTKTLLDLVQQAANYKQLRK------GANEATKTLNRGIAEFIVMAADAEPLEIILHLP 70

  Fly   177 ALCRKMGVPYCIVKGKARLGR 197
            .||....|||..|:.|..|||
 Frog    71 LLCEDKNVPYVFVRSKQALGR 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 29/86 (34%)
Ribosomal_L7Ae 37..257 CDD:294400 29/86 (34%)
snu13NP_988994.1 Rpl7Ae 9..103 CDD:224277 29/86 (34%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000250|UniProtKB:P55769 36..48 5/17 (29%)
Important for U4 snRNA-binding. /evidence=ECO:0000250|UniProtKB:P55769 96..128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.