DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and CG11808

DIOPT Version :10

Sequence 1:NP_511063.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster


Alignment Length:184 Identity:36/184 - (19%)
Similarity:58/184 - (31%) Gaps:59/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIR 67
            |.||:.||...:||.:.                  ..|..:....::....|..||........|
  Fly    45 VSKPKKKKAKKSKKYSR------------------RSRSSSRSTSRSSSSSRSSSRSTHSKSRTR 91

  Fly    68 -VQRQKAVLQKRLKVPPPIHQFSQTLDKTT-------AVKLF-----KLLE-----KYRPESPLA 114
             ..:.:::.|::.:.|   ...|.:...||       |:.||     |.||     .::|||..:
  Fly    92 DHHKSRSISQRKTRGP---SSESNSRSATTPAAAPVKAIDLFDTKVQKALETIDEDTFKPESFFS 153

  Fly   115 KKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLV----VIAH 164
            .:                :.|:....|....|..|..:..|.|..|    ||.|
  Fly   154 SR----------------DSKETSDKVIIDLNNETVTVASKPATAVRNEDVIFH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_511063.1 SNU13 18..271 CDD:455736 29/169 (17%)
CG11808NP_611021.1 None

Return to query results.
Submit another query.