DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and Rsl1d1

DIOPT Version :10

Sequence 1:NP_511063.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001316127.1 Gene:Rsl1d1 / 302898 RGDID:1359295 Length:453 Species:Rattus norvegicus


Alignment Length:172 Identity:38/172 - (22%)
Similarity:57/172 - (33%) Gaps:49/172 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKKPRPKKKPVTKKVAPAPLAVKKPVVKK-------VVNQ--LFEKRPKNFGIGQNVQPKRDLSR 58
            :||..|||:   :|.....|..:..::||       ::.|  |....|..   |...|.||.   
  Rat   279 LKKQEPKKR---RKHEKQKLKKESKMLKKKSKKATSLLTQGGLVSSAPAK---GPGAQKKRT--- 334

  Fly    59 FVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLE----------KYRPESPL 113
                   .:...|..|.::..:..|.:....:|.||..    .|:.|          |..|.:|.
  Rat   335 -------SKASTQPKVTEEYEETIPQLVPIGETPDKEN----MKMQENITGKKSPKSKSDPRTPQ 388

  Fly   114 AKKLRLKKIAE----------AKAKGKDVEPKKKPSYVSAGT 145
            .||.:.....|          .|.:.|||...:||...|..|
  Rat   389 GKKRKALPATETPEASDPGISGKKQKKDVREFRKPGAKSFST 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_511063.1 SNU13 18..271 CDD:455736 32/157 (20%)
Rsl1d1NP_001316127.1 Ribosomal_L1 48..257 CDD:459905
PTZ00449 <315..>447 CDD:185628 29/133 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.