DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and Rpp38

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001028235.1 Gene:Rpp38 / 291317 RGDID:1307474 Length:272 Species:Rattus norvegicus


Alignment Length:235 Identity:49/235 - (20%)
Similarity:85/235 - (36%) Gaps:74/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSR--FVRWPKYIRVQRQKAVLQKRL 79
            :|.||.|.|:..::|.       ||        :..|..|:.  .:.|..   ::|:        
  Rat     1 MAAAPQAPKRGSIRKT-------RP--------LVVKTSLNNPYVISWSS---LERE-------- 39

  Fly    80 KVPPPIHQFSQTL-DKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKP----- 138
                .:|...||| ||..::.|              :|:..||..:||.:|..|...::|     
  Rat    40 ----DMHFILQTLEDKFKSIGL--------------QKIEDKKKRKAKQRGGLVGTSEEPQEPHG 86

  Fly   139 -------------SYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYC-IV 189
                         ..::.|.|.||:.:|:.:..||::...|.|..:...|..|.....||.| :.
  Rat    87 GVRVSGWTPVHTRKQLAIGVNEVTRALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVP 151

  Fly   190 KGKARLGRLVRRKTCTTLAL--TTVDNNDKANFGKVLEAV 227
            :...|:..::..|....|..  .|:|      |...:||:
  Rat   152 QLSERIAPVIGLKCVLALGFRKNTMD------FADEVEAI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 49/234 (21%)
Ribosomal_L7Ae 37..257 CDD:294400 43/215 (20%)
Rpp38NP_001028235.1 Ribosomal_L7Ae 100..174 CDD:279573 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.