DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and Rpp38

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_030105367.1 Gene:Rpp38 / 227522 MGIID:2443607 Length:350 Species:Mus musculus


Alignment Length:231 Identity:49/231 - (21%)
Similarity:84/231 - (36%) Gaps:58/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSR--FVRWPKYIRVQRQKAVLQKR 78
            |:|.||.|.|:..::|.       ||        :..|..|:.  .:.|          :.|::.
Mouse    70 KMAAAPQAPKRGSIRKT-------RP--------LVVKTSLNNPYVISW----------STLERE 109

  Fly    79 LKVPPPIHQFSQTLDKTTAVKLFKLL-------EKYRPESPLAKKLRLKKIAEAKAKGKDVE--- 133
                 .||...|||:..     |||:       :|.|.::.|.||...:...|.....|:.:   
Mouse   110 -----DIHFILQTLEAK-----FKLIGLQKIEDKKKRKKTALMKKQSCRPDIEISEDPKEPDGDV 164

  Fly   134 ------PKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYC-IVKG 191
                  |......:..|.|.||:.:|:.:..||::...|.|..:...|..|.....||.| :.:.
Mouse   165 LVSGWTPVHVRKQLVIGVNEVTRALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVPQL 229

  Fly   192 KARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAV 227
            ..|:..::..|....|..    ..:..:|...:||:
Mouse   230 SERIAPVIGLKCVLALGF----RKNTRDFADEVEAI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 48/229 (21%)
Ribosomal_L7Ae 37..257 CDD:294400 42/210 (20%)
Rpp38XP_030105367.1 Ribosomal_L7Ae 172..250 CDD:366537 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.