DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and rpl-7A

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_741371.2 Gene:rpl-7A / 177203 WormBaseID:WBGene00004419 Length:265 Species:Caenorhabditis elegans


Alignment Length:263 Identity:154/263 - (58%)
Similarity:200/263 - (76%) Gaps:2/263 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKKPVTKKVA--PAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQR 70
            |.||.:.||||  ||.:..:..|.|:|.|.|||||.:||.|||::|||:|::|||:||||||:||
 Worm     2 PSKKVIKKKVAAVPAHIRAQTQVQKEVKNPLFEKRARNFNIGQDIQPKKDVTRFVKWPKYIRLQR 66

  Fly    71 QKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPK 135
            |.|:|||||||||.|:||...||..:|.:.||||:||||||..|||.||:..|||:|.||..|..
 Worm    67 QSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPESTEAKKNRLRARAEARAAGKKEEVT 131

  Fly   136 KKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVR 200
            |:|:.|..|.||:|:|:|.::||||:|||||:|||:||.|||||||..|||.|:||||.||.:||
 Worm   132 KRPNTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKASLGTVVR 196

  Fly   201 RKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARE 265
            |||...:||..|:..||:...|::|.|..||:|||||||:|||||::.:||.|:..|:|||:||:
 Worm   197 RKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWGGGVMSAKSDAKKLKIERARARD 261

  Fly   266 LAQ 268
            |.:
 Worm   262 LGK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 148/253 (58%)
Ribosomal_L7Ae 37..257 CDD:294400 133/219 (61%)
rpl-7ANP_741371.2 PTZ00365 20..264 CDD:240382 145/243 (60%)
Ribosomal_L7Ae 33..264 CDD:294400 140/230 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159288
Domainoid 1 1.000 148 1.000 Domainoid score I2759
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H135416
Inparanoid 1 1.050 310 1.000 Inparanoid score I1560
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54180
OrthoDB 1 1.010 - - D1200503at2759
OrthoFinder 1 1.000 - - FOG0000860
OrthoInspector 1 1.000 - - oto20795
orthoMCL 1 0.900 - - OOG6_101259
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1145
SonicParanoid 1 1.000 - - X505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.