DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and RPP38

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001091059.1 Gene:RPP38 / 10557 HGNCID:30329 Length:283 Species:Homo sapiens


Alignment Length:152 Identity:39/152 - (25%)
Similarity:70/152 - (46%) Gaps:19/152 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IHQFSQTL-DKTTAVKLFKLLEKYRP-ESPLAKKLRLKKIAEAKAKGKDVEPKK----------K 137
            :|...||| |:..|:.|.|:.:|.:. ::|..||...:|.:.|....::::.||          .
Human    41 MHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWT 105

  Fly   138 PSYV----SAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYC-IVKGKARLGR 197
            |::|    :.|.|.||:.:|:::..||::...|.|..:...|..|.....||.| :.:...|:..
Human   106 PAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAP 170

  Fly   198 LVRRKTCTTLAL--TTVDNNDK 217
            ::..|....||.  .|.|..|:
Human   171 VIGLKCVLALAFKKNTTDFVDE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 39/152 (26%)
Ribosomal_L7Ae 37..257 CDD:294400 39/152 (26%)
RPP38NP_001091059.1 Ribosomal_L7Ae 107..185 CDD:396000 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.