DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and Rps12l1

DIOPT Version :10

Sequence 1:NP_511063.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001395896.1 Gene:Rps12l1 / 100360573 RGDID:2321884 Length:132 Species:Rattus norvegicus


Alignment Length:98 Identity:21/98 - (21%)
Similarity:38/98 - (38%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCT 205
            ::.|.....|.:::::|.|.|:|.:.|....|..:.|||.:..:....|....:||..|      
  Rat    31 LARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWV------ 89

  Fly   206 TLALTTVDNNDK------------ANFGKVLEA 226
              .|..:|...|            .::||..:|
  Rat    90 --GLCKIDREGKPRKVVGCSCVVVKDYGKESQA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_511063.1 SNU13 18..271 CDD:455736 21/98 (21%)
Rps12l1NP_001395896.1 Ribosomal_L7Ae 16..111 CDD:426153 18/87 (21%)

Return to query results.
Submit another query.