DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7A and nhp2

DIOPT Version :9

Sequence 1:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_997762.1 Gene:nhp2 / 100003787 ZFINID:ZDB-GENE-030131-533 Length:150 Species:Danio rerio


Alignment Length:130 Identity:34/130 - (26%)
Similarity:55/130 - (42%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFL 175
            :|:|..|..:|:  :|...|.|:...|...:..|...|.|.|.:.:..:||.|.|..|:::...|
Zfish    29 NPIANPLASRKL--SKKLYKCVKKAAKVKQIRRGVKEVQKFINKGETGIVVFAGDTLPIDVYCHL 91

  Fly   176 PALCRKMGVPYCIVKGKARLGRLV--RRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEI 238
            |.:|....:||..|..|..||...  :|.||..:.             |..:..|..::|..||:
Zfish    92 PIMCEDRSLPYAYVPSKVDLGSSAGSKRPTCVIMI-------------KPHDEYKEAYDECVEEV 143

  Fly   239  238
            Zfish   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 34/130 (26%)
Ribosomal_L7Ae 37..257 CDD:294400 34/130 (26%)
nhp2NP_997762.1 Ribosomal_L7Ae 56..136 CDD:279573 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.