DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spat and CG11899

DIOPT Version :9

Sequence 1:NP_511062.1 Gene:Spat / 31587 FlyBaseID:FBgn0014031 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_652046.1 Gene:CG11899 / 46391 FlyBaseID:FBgn0014427 Length:364 Species:Drosophila melanogaster


Alignment Length:215 Identity:50/215 - (23%)
Similarity:82/215 - (38%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GPSNCSHRVL-EAMSNPV-----------LGHMHPECLQIMDEVKEGIKYIFQTLNDATMCISGA 76
            ||:.....|| |...|.|           :.|......:|.|.....::.:....::..:.:...
  Fly     8 GPAKLPEEVLKEVQENLVNCNGSGISVMEMSHRSSNYAKIHDATISDLRELLNVPSNYKILLMQG 72

  Fly    77 GHSGMEAALC-NLIEDGDVVLMGITGVWGHRAGDMARRYGAEVHYVEASFGRALSHEEI----TF 136
            |.:|..||:. |||.........|||.|..:|...|.:||.    |.|...:...:..:    |:
  Fly    73 GGTGQFAAVALNLIGKTGTADYVITGSWSAKAAKEAAQYGT----VNAVLPKLAKYTTVPRQETW 133

  Fly   137 AFEAHRPKVFFIAQGDSSTGIIQQNIREL--GELCRKYDCFLIVDTVASLGGTEFL---MDEWKV 196
            ..:.:...|:: ...::..|:....:.|:  |           |..||.: .:.||   .|..|.
  Fly   134 KLDPNASYVYY-CDNETVEGVEFDFVPEVPAG-----------VPLVADM-SSNFLSRPFDVSKF 185

  Fly   197 DVAYTGSQKSLGGPAGLTPI 216
            .|.|.|:||:: ||||.|.|
  Fly   186 GVIYAGAQKNI-GPAGTTVI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpatNP_511062.1 PucG 16..389 CDD:223153 50/215 (23%)
AGAT_like 19..381 CDD:99744 50/215 (23%)
CG11899NP_652046.1 PSAT_like 3..360 CDD:99736 50/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.