DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spat and SPAC11D3.10

DIOPT Version :9

Sequence 1:NP_511062.1 Gene:Spat / 31587 FlyBaseID:FBgn0014031 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_592807.1 Gene:SPAC11D3.10 / 2542999 PomBaseID:SPAC11D3.10 Length:434 Species:Schizosaccharomyces pombe


Alignment Length:317 Identity:69/317 - (21%)
Similarity:124/317 - (39%) Gaps:62/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GAEVHYV--EASFGRALSHEEITFAFEAHRPKVFFIAQGDSSTGII----------QQN-IRELG 166
            |.||..|  |..:....|    |||     |.|      ||.|..|          |:| ::::.
pombe   128 GLEVRLVPNEGQYHANAS----TFA-----PYV------DSRTKAIGLSSVMFHSGQKNDVKDIA 177

  Fly   167 ELCRKYDCFLIVDTVASLGGTEFLMDEWKVDVAYTGSQKSLGGPAGLTPISFSKRALTRIRKRKT 231
            ...|.....::.|....:|.::..:.:..|........|.||.|.||..:..|..|::.:  |.|
pombe   178 NAFRPKGIHVLADLTQQVGLSKIDVQDLNVSACAFSCHKGLGCPTGLGVLYVSPLAISEL--RST 240

  Fly   232 KPKV-------YYFD--ILLIGQYWGCYGTPRIYHHTISS-TLLYGLREALAHFCAVGLKAVVRR 286
            .|.|       :..|  :.|..:|   :.:...|.||.:: .|:..||..|.....||:..|.|.
pombe   241 PPFVGGGAVEDFKEDLKLKLNAKY---HQSALRYEHTNNAYMLITALRAYLKFLLKVGISNVERY 302

  Fly   287 HQECSKRLQLGIEELGLEMFVSREEERLPT---VNTIKVPFGVDWKKVAEYAMRKY--SVEISGG 346
            .|...|.|...:|.|.:.:...::.::..:   |..|..|...|:.:.....:.::  .:.:|.|
pombe   303 LQGLGKDLIKELESLNVSVIGYKDFDKHSSHSYVLKILNPEWFDFLRQQGVCVSRFESGIRVSFG 367

  Fly   347 LGPTVEHVFR-IGLMGENATV---------ERV----DMVLSILNEAIQSSKLGIKT 389
            |..|.:.:.: |.::.:...:         :|:    :.::.|.:|||.:.||...|
pombe   368 LYNTSKDIIKFISVIRKGLALNIPLNIRPPQRIAVMDNPLVGISDEAIAAMKLPANT 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpatNP_511062.1 PucG 16..389 CDD:223153 68/315 (22%)
AGAT_like 19..381 CDD:99744 65/307 (21%)
SPAC11D3.10NP_592807.1 CsdA 1..388 CDD:223594 61/279 (22%)
AAT_I 61..382 CDD:302748 61/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.