DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spat and SPBC660.12c

DIOPT Version :9

Sequence 1:NP_511062.1 Gene:Spat / 31587 FlyBaseID:FBgn0014031 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_595091.1 Gene:SPBC660.12c / 2541092 PomBaseID:SPBC660.12c Length:392 Species:Schizosaccharomyces pombe


Alignment Length:332 Identity:67/332 - (20%)
Similarity:118/332 - (35%) Gaps:66/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YIFQTLNDATMCISGAGHSGMEAALCNLIEDG--------------DVVLMGITGVWGHRAGDMA 111
            |:..|.|:....| ||..|.:  ..||...||              :::::.:.......|.|.|
pombe    62 YMEATRNEVAKLI-GADSSNI--VFCNSATDGISTVLLTFPWEQNDEILMLNVAYPTCTYAADFA 123

  Fly   112 R---RYGAEVHYVEASFGRALSHEEITFAFEAHRPKVFFIAQGDSSTGIIQQNIRELGELCRKYD 173
            :   ....:|..|.......|..:|:...|...:|:. ||....||..:|.....::.:||:||:
pombe   124 KNQHNLRLDVIDVGVEIDEDLFLKEVEQRFLQSKPRA-FICDILSSMPVILFPWEKVVKLCKKYN 187

  Fly   174 CFLIVDTVASLGGTEFLMDEWKVDVAYTGSQKSLGGPAGLTPISFSKRALTRIRKRKTKPKVYYF 238
            ...|:|...::|.....:.....|..:|.:.|.|..||..|.:..|.:....|            
pombe   188 IVSIIDGAHAIGHIPMNLANVDPDFLFTNAHKWLNSPAACTVLYVSAKNHNLI------------ 240

  Fly   239 DILLIGQYWGCYGTPRIYHHTISSTLLYGLREALAHFCAVGLKAVVRR------------HQECS 291
            :.|.:...:|......|...|:::..:...::.|..|.|||.....|:            |:...
pombe   241 EALPLSYGYGLREKESIAVDTLTNRFVNSFKQDLPKFIAVGEAIKFRKSIGGEEKIQQYCHEIAL 305

  Fly   292 KRLQLGIEELGLEMF----------VSREEERLPTVNTIKVPFGVDWKKVAEYAMR------KYS 340
            |..::..:|||....          |......:|::.|.|    |.|.|...: :|      |:.
pombe   306 KGAEIISKELGTSFIKPPYPVAMVNVEVPLRNIPSIETQK----VFWPKYNTF-LRFMEFKGKFY 365

  Fly   341 VEISGGL 347
            ..:||.:
pombe   366 TRLSGAV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpatNP_511062.1 PucG 16..389 CDD:223153 67/332 (20%)
AGAT_like 19..381 CDD:99744 67/332 (20%)
SPBC660.12cNP_595091.1 CsdA 23..390 CDD:223594 67/332 (20%)
AAT_I 64..>305 CDD:302748 51/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2022
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.