DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spat and Agxt

DIOPT Version :9

Sequence 1:NP_511062.1 Gene:Spat / 31587 FlyBaseID:FBgn0014031 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_057911.2 Gene:Agxt / 11611 MGIID:1329033 Length:414 Species:Mus musculus


Alignment Length:379 Identity:180/379 - (47%)
Similarity:245/379 - (64%) Gaps:1/379 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VPPPLVLKRPLYVPSKTLMGPGPSNCSHRVLEAMSNPVLGHMHPECLQIMDEVKEGIKYIFQTLN 67
            ||||..|.:||.||::.|:||||||.:.|||.|.|..::|||..|.||||:|:|:||:|:|||.|
Mouse    30 VPPPEALSKPLSVPTRLLLGPGPSNLAPRVLAAGSLRMIGHMQKEMLQIMEEIKQGIQYVFQTRN 94

  Fly    68 DATMCISGAGHSGMEAALCNLIEDGDVVLMGITGVWGHRAGDMARRYGAEVHYVEASFGRALSHE 132
            ..|:.:||:||..||.||.||:|.||..|.|..|:||.||.::|.|.||.||.:....|...:.:
Mouse    95 PLTLVVSGSGHCAMETALFNLLEPGDSFLTGTNGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQ 159

  Fly   133 EITFAFEAHRPKVFFIAQGDSSTGIIQQNIRELGELCRKYDCFLIVDTVASLGGTEFLMDEWKVD 197
            |:......|:|.:.|:..|:||||::|. :...||||.:|.|.|:||:||||||....||:..:|
Mouse   160 EVEEGLAQHKPVLLFLVHGESSTGVVQP-LDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGID 223

  Fly   198 VAYTGSQKSLGGPAGLTPISFSKRALTRIRKRKTKPKVYYFDILLIGQYWGCYGTPRIYHHTISS 262
            :.|:.|||.|..|.|::.|||:.:|..::..|||||..:|.||..:.:.|||.|..|:.|||...
Mouse   224 IMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKPVSFYTDITYLAKLWGCEGETRVIHHTTPV 288

  Fly   263 TLLYGLREALAHFCAVGLKAVVRRHQECSKRLQLGIEELGLEMFVSREEERLPTVNTIKVPFGVD 327
            |.||.|||:||.....||:...|||:|.:..|...::|:||:.||...|.||||:.|:.||.|.:
Mouse   289 TSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGYN 353

  Fly   328 WKKVAEYAMRKYSVEISGGLGPTVEHVFRIGLMGENATVERVDMVLSILNEAIQ 381
            |:.:..|.:..:|:|||||||||.|.|.||||:|.|||.|.||.|...|.||:|
Mouse   354 WRDIVSYVLDHFSIEISGGLGPTEERVLRIGLLGYNATTENVDRVAEALREALQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpatNP_511062.1 PucG 16..389 CDD:223153 172/366 (47%)
AGAT_like 19..381 CDD:99744 170/361 (47%)
AgxtNP_057911.2 PucG 43..406 CDD:223153 170/363 (47%)
AGAT_like 46..407 CDD:99744 170/361 (47%)
Microbody targeting signal. /evidence=ECO:0000250 412..414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850843
Domainoid 1 1.000 336 1.000 Domainoid score I1113
eggNOG 1 0.900 - - E1_COG0075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37251
Inparanoid 1 1.050 365 1.000 Inparanoid score I2146
Isobase 1 0.950 - 0 Normalized mean entropy S2200
OMA 1 1.010 - - QHG61020
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003987
OrthoInspector 1 1.000 - - oto94856
orthoMCL 1 0.900 - - OOG6_100588
Panther 1 1.100 - - LDO PTHR21152
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2022
SonicParanoid 1 1.000 - - X3850
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.