DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA8H

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001269419.1 Gene:GOLGA8H / 728498 HGNCID:37443 Length:632 Species:Homo sapiens


Alignment Length:278 Identity:51/278 - (18%)
Similarity:108/278 - (38%) Gaps:79/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SKIRTKATVTKTTPNPPQPQPRSRVT-------------LPTLEKADDEERE--------RETET 239
            :|.:.|....|.:|..|....|:|.|             .|..:.|....||        ::.|:
Human    13 AKKKLKEYWQKNSPRVPAGANRNRKTNGSVPEKATSGGCQPPGDSATGFHREGPTSSATLKDLES 77

  Fly   240 PSNEDVIVTPVPRPIGSSNAHRKLSASSLAVANASTSSDTPLAVTTLDKYLDEQRASGALMEHKM 304
            |..|..:|               |.:.|:.::....:.          |.|.:|:..   :||::
Human    78 PCQERAVV---------------LDSRSVEISQLKNTI----------KSLKQQKKQ---VEHQL 114

  Fly   305 DAILQAMNRMGGQSSVAPKKPSDPLLERDSEDEMLELEQKLLNLKR-----ENRALMRNLKAREQ 364
            :...:|.|:                  :.....:||::.:.||:::     :...:.|:|:..|:
Human   115 EEEKKANNK------------------KQKAKRVLEVQIQTLNIQKGKLNTDLYHMKRSLRYFEE 161

  Fly   365 ALEDLRCSACALC-EELLVQNGELKSQNAQLLLASQHISDSSTAASPAHCR-NCESSSRQIAKMQ 427
            ..:||     |:| :..|.:.|||:|..:.::...:..::..::.|.|... ..|.|.|:.|.::
Human   162 KSKDL-----AVCLQHSLQRKGELESVLSNVMATQKKKANQLSSRSKARTEWKLEQSMREEALLK 221

  Fly   428 LHISALQEALRIFQKSGD 445
            :.::.|:|:.:..|...|
Human   222 VQLTQLKESFQQVQLERD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA8HNP_001269419.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77 12/63 (19%)
DUF342 <175..291 CDD:302792 14/65 (22%)
GOLGA2L5 226..621 CDD:291729 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..379
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..452
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 496..524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.