DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA6L6

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001138476.2 Gene:GOLGA6L6 / 727832 HGNCID:37225 Length:724 Species:Homo sapiens


Alignment Length:276 Identity:54/276 - (19%)
Similarity:95/276 - (34%) Gaps:94/276 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LPVEHYLSEISSSSSASPSREDLSKIRTKATVTKTTPNPPQPQPRSRVTLPTLEKADDEERERET 237
            ||....:|:.:..|..:.::|.|            |.:.||       |.|::..|..:.::::.
Human    33 LPTHPMMSKETRQSKLAEAKEQL------------TDHHPQ-------TNPSVGTAASDTKKKKI 78

  Fly   238 ETPSNEDVIVTPVPRPIGSSNAH-----------------RKLSASSLAVANASTSSDTPL---- 281
            ...:|        |....|...|                 |:|.| .:......|...|.|    
Human    79 NNGTN--------PETTTSGGCHSPEDEQKASHQHQEALRRELEA-QVHTIRILTCQKTELQMAL 134

  Fly   282 -----AVTTLD--------KYLDEQRASGALMEHKMDAILQAMNRMGGQSSVAPKKPSDPLLERD 333
                 ||..|:        :..|..:.:|.|.        ||::.:..|...|.:...:...|||
Human   135 YYSQHAVKQLEGEARDLISRLHDSWKFAGELE--------QALSAVATQKKKADRYIEELTKERD 191

  Fly   334 S----------EDEML-----ELEQKLLNLKRENRALMRNLKAREQALE---------DLRCSAC 374
            :          .||.|     ||::||..::.|...:..|:|..::.||         .|:..|.
Human   192 ALSLELYRNTITDEELKEKNAELQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEAD 256

  Fly   375 ALCEELLVQNGELKSQ 390
            .|.:||...:.:|::|
Human   257 HLGKELQSVSAKLQAQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA6L6NP_001138476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..108 16/101 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..342
TPH 367..713 CDD:290579
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 561..724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.