DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA6D

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001138696.1 Gene:GOLGA6D / 653643 HGNCID:32204 Length:693 Species:Homo sapiens


Alignment Length:454 Identity:88/454 - (19%)
Similarity:155/454 - (34%) Gaps:70/454 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DQSYQDFFDKLRSESGPRNLRQIFEDDDRPLANESSSLRYQPGSSKKLQAGKRPAMTRS------ 64
            |..||:....|  ||....:.|:.|:.: .|..:...:.:|...:||.......|....      
Human    68 DSQYQELAVAL--ESSSVTINQLNENIE-SLKQQKKQVEHQLEEAKKTNNEIHKAQMEQLETINI 129

  Fly    65 STQETGDSPPAAWNTAIAKVVHAYRSSENVGRVGLALSILGEMEASKLIVYRSKSQVLTTLQLTP 129
            .|.|..|.....::|..|.......|.:..||:..:|..:.|:|       |:...|.|..|...
Human   130 LTLEKADLKTTLYHTKRAARHFEEESKDLAGRLQYSLQHIQELE-------RALCAVSTQQQEED 187

  Fly   130 RGGKVILRESYLQFYDDEQRFWSLRFDKEPDEKEFITFMVKN--------KLPVEHYLSEISSSS 186
            |...  .||:.||          .|..:...|:..:...|..        :|..:.|...|....
Human   188 RSSS--CREAVLQ----------RRLQQTIKERALLNAHVTQVTESLKQVQLERDEYAKHIKGER 240

  Fly   187 SASPSREDLSKIRTKATVTKTTPNPPQPQPRSRVTLPTLEKADDEERERETETPSNEDVIVTPVP 251
            :.  .:|.:.|:..:|...|      :.:.|....:..||::..|.:.:..|.||.....||.|.
Human   241 AR--WQERMWKMSVEARTLK------EEKKRDIHRIQELERSLSELKNQMAEPPSLAPPAVTSVV 297

  Fly   252 RPIGSSNAHRKLSASSLAVANASTSSDTPLAVTTLDKYLDEQRASGALMEHKMDAILQAMNRMGG 316
            ..:.....|.:.....|. ....:..:...|::.|.|   ||:..           ||....|..
Human   298 EQLQDEAKHLRQEVEGLE-GKLQSQVENNQALSLLSK---EQKQR-----------LQEQEEMLR 347

  Fly   317 QSSVAPKKPSDPLLERDSEDEMLELEQKLL-----NLKRENRALMR---NLKAREQALEDLRCSA 373
            :......:..:.|.|   ::|.|..:||.|     .|:::.:.|.:   .|:..|:.|:......
Human   348 EQEAQRVREQERLCE---QNERLREQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRL 409

  Fly   374 CALCEELLVQNGELKSQNAQLLLASQHISDSSTAASPAHCRNCESSSRQIAKMQLHISALQEAL 437
            ....|.|..:...|:.|..:|.|:..|..|...|.......:..:..:...:::..:..|||.|
Human   410 WDQEERLWKKEERLQKQEERLALSQNHKLDKQLAEPQCSFEDLNNEKKSALQLEQQVKELQEKL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA6DNP_001138696.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..70 1/1 (100%)
GOLGA2L5 217..686 CDD:291729 52/283 (18%)
V_ATPase_I 264..>346 CDD:279793 18/96 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..547
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 662..693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.