DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA8K

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001269422.1 Gene:GOLGA8K / 653125 HGNCID:38652 Length:630 Species:Homo sapiens


Alignment Length:280 Identity:51/280 - (18%)
Similarity:106/280 - (37%) Gaps:77/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SKIRTKATVTKTTPNPPQPQPRSRVT-------------LPTLEKADDEERE--------RETET 239
            :|.:.|....|.:|..|....|:|.|             .|..:.|....||        ::.|:
Human    13 AKKKLKEYWQKNSPRVPAGANRNRKTNGSIPEKATSGGCQPPRDSATGFHREGPTSSATLKDLES 77

  Fly   240 PSNEDVIVTPVPRPIGSSNAHRKLSASSLAVANASTSSDTPLAVTTLDKYLDEQRASGALMEHKM 304
            |..|..:|               |.:.|:.::....:.          |.|.:|:..   :||::
Human    78 PCQERAVV---------------LDSRSVEISQLKNTI----------KSLKQQKKQ---VEHQL 114

  Fly   305 DAILQAMNRMGGQSSVAPKKPSDPLLERDSEDEMLELEQKLLNLKREN-----RALMRNLKAREQ 364
            :...:|.|:                  :.....:||::.:.||:::|.     ..:.|:|:..|:
Human   115 EEEKKANNK------------------KQKAKRVLEVQIQTLNIQKEELNTDLYHMKRSLRYFEE 161

  Fly   365 ALEDLRCSACALCEELLVQNGELKSQNAQLLLASQHISDSSTAASPAHCR-NCESSSRQIAKMQL 428
            ..:||    ....:..|.:.|||:|..:.::...:..::..::.|.|... ..|.|.|:.|.:::
Human   162 KSKDL----AVRLQHSLQRKGELESVLSNVMATQKKKANQLSSRSKARTEWKLEQSMREEALLKV 222

  Fly   429 HISALQEALRIFQKSGDSSS 448
            .::.|:|:.:..|...|..|
Human   223 QLTQLKESFQQVQLERDEYS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA8KNP_001269422.1 DUF342 <175..291 CDD:302792 15/68 (22%)
GOLGA2L5 226..620 CDD:291729 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.