DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA6L4

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001254465.2 Gene:GOLGA6L4 / 643707 HGNCID:27256 Length:574 Species:Homo sapiens


Alignment Length:316 Identity:60/316 - (18%)
Similarity:112/316 - (35%) Gaps:45/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RFDKEP--DEKEFITFMVKNKLPVEHYLSEISSSSSASPSREDLSKIRTKATVTKTTPNPPQP-- 214
            ||...|  .||.....:...|..::.|....|....|..:|:  .||...:..|.|:.....|  
Human     6 RFPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRK--KKINGSSPDTATSGGYHSPGD 68

  Fly   215 -----QPRSRVTLPTLEKADDEERERETETPSNEDVI------VTPVPRPIGSSNAH-----RKL 263
                 ....|.:..|||..:.:.:|......|:..:|      :..:.|.......|     :||
Human    69 SATGIYGEGRASSTTLEDLESQYQELAVALDSSSAIISQLTENINSLVRTSKEEKKHEIHLVQKL 133

  Fly   264 SASSLAVANAST---SSDTPLAVTTLDKYLDEQRASGALMEHKMDAI---LQAMNRMGGQSSVAP 322
            ..|...:.|.:.   :.:.|...:.:::..||...    :..:::::   |||........|:..
Human   134 GRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNH----LRKELESVGRQLQAEVENNQMLSLLN 194

  Fly   323 KKPSDPLLE-----RDSEDEMLELEQKLLNLKRENRALMRNLKAREQALEDLRCSACALCEELLV 382
            ::..:.|.|     |:.|:.:.|.|.:|...:...|.....|..:|:.|.:.....|...|.|..
Human   195 RRQEERLREQEERLREQEERLREQEDRLHEQEERLREQEERLCEQEERLREHEERLCEQEERLCE 259

  Fly   383 QNGELKSQNAQLLLASQHISDSSTAASPAHCRNCESSSRQIAKMQLHISALQEALR 438
            |...|:.|..:|....:.:.:...       |.||...| :.:.:..:...:|.||
Human   260 QEERLREQEERLHEQEERLREQEE-------RLCEQEER-LREQEERLCEQEERLR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA6L4NP_001254465.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77 15/72 (21%)
GOLGA2L5 83..>194 CDD:291729 19/114 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..552
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.