DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA8N

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001269423.1 Gene:GOLGA8N / 643699 HGNCID:44405 Length:632 Species:Homo sapiens


Alignment Length:370 Identity:63/370 - (17%)
Similarity:130/370 - (35%) Gaps:119/370 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LSEISSSSSASPSREDLSKIR----TKATVTKTTPNPPQPQ-----------PRSRVTLPTLEKA 228
            :.|.::|....|..:..:...    |.:...|...:|.|.:           .|.:.|:.:|::.
Human    42 IPETATSGGCQPPGDSATGFHREGPTSSATLKDLESPCQERAVVLDSTSVKISRLKNTIKSLKQQ 106

  Fly   229 DDE-ERERETETPSNEDVIVTPVPRPIGSSNAHRKLSA--SSLAVANASTSSDTPLAVTTLDKYL 290
            ..: |.:.|.|..:|.:           ...|.|:|..  .:|.:.....::|......:| :|.
Human   107 KKQVEHQLEEEKKANNE-----------RQKAERELEVQIQTLIIQKEELNTDLYHMERSL-RYF 159

  Fly   291 DEQRASGAL-----------MEHKMDAILQAMNRMGGQSSVAPKKPSDPLLERDSEDE------- 337
            :|:....|:           :|..:.|::....:...|.|...|..::..||:..:|:       
Human   160 EEESKDLAVRLQHSLQCKGELESALSAVIATEKKKANQLSSCSKAHTEWELEQSLQDQALLKAQL 224

  Fly   338 -------------------------------MLELEQKLLNLKRENRALMRNLKAREQALEDLRC 371
                                           |.::.|::..||:|.:..||.::..|::|..|:.
Human   225 TQLKESFQQLQLERDECAEHIEGERARWHQRMSKMSQEICTLKKEKQQDMRRVEELERSLSKLKN 289

  Fly   372 SAC--------ALCEELLVQN---------GELKSQNAQLLLASQHISDSSTAASPAHCRNCESS 419
            ...        |:..|:.:|:         |||:||    :..:||||..:        |..|..
Human   290 QMAEPLPPEPPAVPSEVELQHLRKELERVAGELQSQ----VKNNQHISLLN--------RRQEER 342

  Fly   420 SRQ----IAKMQLHISALQEALR-------IFQKSGDSSSSSGRL 453
            .|:    :.|.:..:....|.||       :|::..:.:.|:.:|
Human   343 IREQEERLRKQEERLQEQHEKLRQLAKPQSVFEELNNENKSTLQL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA8NNP_001269423.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 5/33 (15%)
GOLGA2L5 226..622 CDD:291729 32/174 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..524
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 552..573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.