DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA6L9

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_937824.3 Gene:GOLGA6L9 / 440295 HGNCID:37229 Length:432 Species:Homo sapiens


Alignment Length:448 Identity:86/448 - (19%)
Similarity:143/448 - (31%) Gaps:155/448 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PGSSKKLQAGKR------------------PAMTRSSTQETGDSPPAAWNTAIAKVVHAYRSSEN 93
            |..|:|.|.||.                  ||......:..|.||    :|..:...|:...|  
Human    11 PAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKINGSSP----DTFTSGGYHSPGDS-- 69

  Fly    94 VGRVGLALSILGEMEASK-------------LIVYRSKSQVLTTLQLTPRGGKVILRESYLQFYD 145
                  |..|.||..||.             .:...|.|.:::  |||.....::          
Human    70 ------ATGIYGEGRASSTTLQDLESQYQELAVALDSSSAIIS--QLTENINSLV---------- 116

  Fly   146 DEQRFWSLRFDKEPDEKEFITFMVKNKLPVEHYLSEISSSSSASPSREDLSKIRTKATVTKTTPN 210
                    |..||..:.|.            |.:.::..|         |.|::.: |.....|.
Human   117 --------RTSKEEKKHEI------------HLVQKLGRS---------LFKLKNQ-TAEPLAPQ 151

  Fly   211 PP---------------------------QPQPRSRVTLPTLEKADDEE-RERETETPSNEDVIV 247
            ||                           |.:..:...|..|.:..:|. ||:|......|:.:.
Human   152 PPAGPSKMEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEERLREQEERLREQEERLC 216

  Fly   248 TPVPRPIGSSNAHRKLSASSLAVANASTSSDTPLAVTTLDKYLDEQRASG--ALMEHKMDAILQA 310
            ....|........|:..                      ::..::::..|  .|:| :::.:|:.
Human   217 EQEERLCEQEERLREQE----------------------ERLCEQEKLPGQERLLE-EVEKLLEQ 258

  Fly   311 MNRMGGQSSVAPKK----PSDPLLERD---SEDEMLELEQKLLNLKRENRALMRNLKAREQALED 368
            ..|...|..:..::    ..:.|||::   .:||.|..::.|..|:| .|.|.|.|:...:||.:
Human   259 ERRQEEQERLLERERLLDEVEELLEQERLRQQDERLWQQETLRELER-LRELERMLELGWEALYE 322

  Fly   369 LRCSACALCEELLVQNGELKSQNAQLLLASQHISDSSTAASPAHCRNCES--SSRQIA 424
            .|....:..|||   |.|.|| ..||....:.:..|..|..|   |..||  ::|.:|
Human   323 QRAEPRSGFEEL---NNENKS-TLQLEQQVKELEKSGGAEEP---RGSESAAAARPVA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA6L9NP_937824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77 17/77 (22%)
GOLGA2L5 83..>222 CDD:291729 25/180 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..411 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.