DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and Gm13547

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_030107713.1 Gene:Gm13547 / 433416 MGIID:3650473 Length:174 Species:Mus musculus


Alignment Length:151 Identity:30/151 - (19%)
Similarity:49/151 - (32%) Gaps:54/151 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 QLTPRGGKVILRESYLQFYDDEQRFWSLRFDKEPDEKEFITFMVKNKLPVEHYLSEISSSSSASP 190
            ||.|.|..||..       |..|.|||.                  ::|.:       .::.|.|
Mouse    60 QLEPNGFAVIKA-------DPGQVFWSA------------------QVPTD-------GTAPAPP 92

  Fly   191 SREDLSKIRTKATVTKTTPNPPQPQPRSRVTLPTLEKADDEERERETETPSNEDVIVTPVPRPIG 255
            :.:|        |:.......|.....|||:|.:.:..:......||:|              ..
Mouse    93 TTDD--------TMFLGVVPCPDADLISRVSLQSHDAGNCSNLMEETKT--------------FS 135

  Fly   256 SSNAHRKLSASSLAVANASTS 276
            |:.:.::||.....:.:.|||
Mouse   136 STESLQQLSQQLNGLVSESTS 156



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.