DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3342 and GOLGA6L2

DIOPT Version :9

Sequence 1:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001291317.1 Gene:GOLGA6L2 / 283685 HGNCID:26695 Length:909 Species:Homo sapiens


Alignment Length:284 Identity:57/284 - (20%)
Similarity:109/284 - (38%) Gaps:64/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LPVEHYLSEISSSSSASPSRE--------DLSKIRTKATVTK-------TTP--------NPPQP 214
            ||....:||.:..:..:.:::        :::.:.|:||.||       |.|        :.|:.
Human     7 LPPHPMMSEKTRQNKLAEAKKKFTDYRQWNIAGVGTRATDTKKKKINNGTNPETTTSEGCHSPED 71

  Fly   215 QPRSRVTLPTLEKADDEERE---RETETPSNEDVIVTPVPRPIG-----SSNAHRKL-------- 263
            ..::|..|...:||..:.:|   ||.|...:...|:|.....:.     |.:|.||.        
Human    72 TQQNRAQLKEEKKASHQHQEALRREIEAQDHTIRILTCQKTELETALYYSQDAARKFEDGNLGTP 136

  Fly   264 SASSLAVANASTSSDTPLAVTTLDKYLDEQRASGALMEHK---MDAILQAMNRMGGQSSVAPKKP 325
            |:.:||::.|...|  ||...:......|.:.....:.|.   ...:.:|::.:......|.:..
Human   137 SSFNLALSQAFRGS--PLGCVSTSLIPGESKDLAGRLHHSWHFAGELQRALSAVSTWHKKADRYI 199

  Fly   326 SDPLLERD-----------SEDEM----LELEQKLLNLKRENRALMRNLKAREQALEDLR----- 370
            .:...|||           :.:|:    .||::||...:.|...:..|:|..::.||..:     
Human   200 EELTKERDALSLELYRNTITNEELKKKNAELQEKLRLAESEKSEIQLNVKELKRKLERAKFLLPQ 264

  Fly   371 CSACALCEELLVQNGELKSQNAQL 394
            .....|.||:..|..||:.|..::
Human   265 VQTNTLQEEMWRQEEELREQEKKI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3342NP_572324.1 None
GOLGA6L2NP_001291317.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 16/80 (20%)
Neuromodulin_N <193..444 CDD:331332 21/96 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..362
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..408
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..494
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..909
Rho 540..>730 CDD:333130
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.