DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elovl4 and CG31523

DIOPT Version :9

Sequence 1:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:319 Identity:123/319 - (38%)
Similarity:176/319 - (55%) Gaps:32/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat    24 EFYRWTWSI----ADKRVEDWPLMQSPWPTLSISTLYLLF-VWLGPKWMKDREPFQMRLVLIIYN 83
            |..:|...:    :|.||.|:.|:.||.|||.:...|..| ..|||:.|..|:|.::|.||::||
  Fly     7 EAQKWYRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYN 71

  Rat    84 FGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILR 148
            ....:.:.:||.|..|..:...||..||.||||.....:|:....|||::||..|:.||:|||||
  Fly    72 AIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILR 136

  Rat   149 KKNNQVSFLHVYHH-CTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYL 212
            |||..||.|||.|| |..|:: |:|:|:..||.:.|.|.:|||:|::||.||.:.|.||..|||:
  Fly   137 KKNEHVSTLHVIHHGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYI 200

  Rat   213 WWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPK-WMHWALIAYAISFIFLFLNFYTRTY-NEPKK 275
            |||:|||..|:|||.....|....|:.:|.:|| :|.| :..:.:.|:|||.:||...| |..::
  Fly   201 WWKKYLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKYLNAARR 264

  Rat   276 SKTGKTA---TNGISANGVNK--SEKQLVLENG-----------------KPQKNGKPK 312
            .:....|   .||.::||.:|  .|...::.||                 |.|.||..|
  Fly   265 RRQAVKANGYANGSASNGHSKHLGEGDALIANGCNTGACMPVMEDEYVKSKGQSNGAYK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 103/240 (43%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 103/238 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.