DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3918 and Srek1ip1

DIOPT Version :9

Sequence 1:NP_572323.1 Gene:CG3918 / 31585 FlyBaseID:FBgn0029873 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_080351.2 Gene:Srek1ip1 / 67288 MGIID:1914538 Length:153 Species:Mus musculus


Alignment Length:180 Identity:71/180 - (39%)
Similarity:98/180 - (54%) Gaps:40/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKDTLRAACKKCGYAGHLTYQCRNFLKVDPNKEILLDVESTSSD------SELDYLTPLTELRAQ 67
            |||.:||.|:||||.||||::|||||:|||.::|:|||.||||:      .||:.|..|.|.|..
Mouse     7 NKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRIN 71

  Fly    68 ELKSGAEVPPPTEPAVLPAAGKRDRSKDKSRDRLKAKKREREREREKVKEKEKEKGSRSKDKKRS 132
            |                    :.::.|:|||:::|.||| |:|......|::.     :|.||:.
Mouse    72 E--------------------EEEKKKEKSREKIKLKKR-RKRSYSSATEEDS-----AKQKKQK 110

  Fly   133 HSKSSHKLAEKSKDKKSVRHKKHGKKRSRKHKKTTNTNNSSSNSSSELAK 182
            :.|...|..:|:|.||...|||..||| :|.|:       ||...|||.|
Mouse   111 YQKKEKKKEKKNKSKKGKHHKKEKKKR-KKEKR-------SSPYHSELTK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3918NP_572323.1 None
Srek1ip1NP_080351.2 zf-CCHC_3 9..>30 CDD:290628 13/20 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..153 46/143 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2985
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4831
Isobase 1 0.950 - 0 Normalized mean entropy S5643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005747
OrthoInspector 1 1.000 - - oto93372
orthoMCL 1 0.900 - - OOG6_109467
Panther 1 1.100 - - LDO PTHR31437
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5838
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.