DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3918 and SREK1IP1

DIOPT Version :9

Sequence 1:NP_572323.1 Gene:CG3918 / 31585 FlyBaseID:FBgn0029873 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_776190.1 Gene:SREK1IP1 / 285672 HGNCID:26716 Length:155 Species:Homo sapiens


Alignment Length:172 Identity:67/172 - (38%)
Similarity:95/172 - (55%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKDTLRAACKKCGYAGHLTYQCRNFLKVDPNKEILLDVESTSSD------SELDYLTPLTELRAQ 67
            |||::||.||||||.||||::|||||:|||.::|:|||.||||:      .||:.|..|.|.|..
Human     7 NKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRIN 71

  Fly    68 ELKSGAEVPPPTEPAVLPAAGKRDRSKDKSRDRLKAKKREREREREKVKEKEKEKGSRSKDKKRS 132
            |                    :.::.|:||::::|.||:.:........|::     .||.||:.
Human    72 E--------------------EEEKKKEKSKEKIKLKKKRKRSYSSSSTEED-----TSKQKKQK 111

  Fly   133 HSKSSHKLAEKSKDKKSVRHKKHGKKRSR-KHKKTTNTNNSS 173
            :.|...|..:|||.||...|||..|||.: ||..|.|::..|
Human   112 YQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3918NP_572323.1 None
SREK1IP1NP_776190.1 zf-CCHC_3 9..>30 CDD:404753 14/20 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..155 41/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2985
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4795
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1616223at2759
OrthoFinder 1 1.000 - - FOG0005747
OrthoInspector 1 1.000 - - oto89801
orthoMCL 1 0.900 - - OOG6_109467
Panther 1 1.100 - - LDO PTHR31437
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5838
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.