DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3918 and C13F10.7

DIOPT Version :9

Sequence 1:NP_572323.1 Gene:CG3918 / 31585 FlyBaseID:FBgn0029873 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_504832.1 Gene:C13F10.7 / 179111 WormBaseID:WBGene00015746 Length:222 Species:Caenorhabditis elegans


Alignment Length:186 Identity:59/186 - (31%)
Similarity:97/186 - (52%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASVNKDTLRAACKKCGYAGHLTYQCRNFLKVDPNKEI-LLDVESTSSDSELDYLTPLTELRAQEL 69
            |:::...:..|||:|||.|||.:||||.::|.||... ..:|.||||:|. |..|||..|..|  
 Worm    67 AAISAPAVTGACKRCGYPGHLYFQCRNHIEVRPNVSTKAYEVSSTSSESS-DDETPLIALEKQ-- 128

  Fly    70 KSGAEVPPPTEPAVLPAAGKRDRSKDKSRDRLKAKKREREREREKVKEKEKEKGSRSKDKKRSHS 134
                                  |.|:|   :||.|.::.:::.:|:::||::|..:.|.::|..|
 Worm   129 ----------------------RKKEK---KLKKKAKKEKKKAKKLEKKERKKERKEKRRRRDDS 168

  Fly   135 KSSHKLAEKS--KDKKSVRHKKHGKKRSRKHKKTTNTNNSSSNSSSELAKTKTGKR 188
            ..|....|:.  |.|||...||  :||.|:| .:::..::||:|..:...:|..:|
 Worm   169 DDSSDSDEEEDRKRKKSKESKK--EKRKRRH-SSSDDRSASSDSDDDCRDSKRHRR 221



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2985
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I3764
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005747
OrthoInspector 1 1.000 - - oto18999
orthoMCL 1 0.900 - - OOG6_109467
Panther 1 1.100 - - LDO PTHR31437
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5838
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.