DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3918 and LOC100362980

DIOPT Version :9

Sequence 1:NP_572323.1 Gene:CG3918 / 31585 FlyBaseID:FBgn0029873 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_008764027.1 Gene:LOC100362980 / 100362980 RGDID:2323713 Length:153 Species:Rattus norvegicus


Alignment Length:180 Identity:69/180 - (38%)
Similarity:99/180 - (55%) Gaps:40/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKDTLRAACKKCGYAGHLTYQCRNFLKVDPNKEILLDVESTSSD------SELDYLTPLTELRAQ 67
            |||.::|.|:||||.||||::|||||:|||.::|:|||.||||:      .||:.|..|.|.|..
  Rat     7 NKDNVQAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEESEELNKLQALQEKRIN 71

  Fly    68 ELKSGAEVPPPTEPAVLPAAGKRDRSKDKSRDRLKAKKREREREREKVKEKEKEKGSRSKDKKRS 132
            |                    :.::.|:|||:::|.||: |:|......|::.     ||.||:.
  Rat    72 E--------------------EEEKKKEKSREKIKLKKK-RKRSNSSTTEEDS-----SKQKKQK 110

  Fly   133 HSKSSHKLAEKSKDKKSVRHKKHGKKRSRKHKKTTNTNNSSSNSSSELAK 182
            :.|...|..:|:|.||...|||..||| :|.|:       ||.:.||:.|
  Rat   111 YQKKEKKKEKKNKSKKGKHHKKEKKKR-KKEKR-------SSPNRSEVTK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3918NP_572323.1 None
LOC100362980XP_008764027.1 zf-CCHC_3 9..>30 CDD:290628 12/20 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005747
OrthoInspector 1 1.000 - - otm45365
orthoMCL 1 0.900 - - OOG6_109467
Panther 1 1.100 - - O PTHR31437
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.