DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and pphB

DIOPT Version :10

Sequence 1:NP_511061.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_417214.1 Gene:pphB / 947196 ECOCYCID:G7415 Length:218 Species:Escherichia coli


Alignment Length:93 Identity:29/93 - (31%)
Similarity:42/93 - (45%) Gaps:16/93 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VTVCGDIHGQFYDLEQLFRTGGQVPHTN-YIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLR 109
            :.|.|||||::..|:.........|..: .|.:||.:|||..||:.. |||.     ....|.::
E. coli    17 IWVVGDIHGEYQLLQSRLHQLSFFPKIDLLISVGDNIDRGPESLDVL-RLLN-----QPWFTSVK 75

  Fly   110 GNHETRQITKVYGFFDECFSKYGNANGW 137
            ||||...:        |.| :.|:.|.|
E. coli    76 GNHEAMAL--------EAF-ETGDGNMW 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_511061.1 MPP_PP2A_PP4_PP6 3..287 CDD:277360 29/93 (31%)
pphBNP_417214.1 PRK09968 1..218 CDD:182173 29/93 (31%)

Return to query results.
Submit another query.