DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and PPH21

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:160/307 - (52%)
Similarity:221/307 - (71%) Gaps:8/307 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRT 65
            :..:|:|||.:.||:.|.|:::.:||:|..|:|..|.|:.|::.|||:|||:||||:||.:||:.
Yeast    67 INQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKI 131

  Fly    66 GGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSK 130
            ||..|.|||:||||:|||||||:||.:.|:.:|.|||.|||:||||||:||||:||||:|||..|
Yeast   132 GGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRK 196

  Fly   131 YGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWS 195
            ||:||.||....:||...|.|::|.::.|:||||||.|.|:||:|.::|..|:|::|..|||:||
Yeast   197 YGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWS 261

  Fly   196 DPEDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYC 260
            ||:|...||.||||||:.||.:|::.|...|:|:||.||||||.||..:.....:||::||||||
Yeast   262 DPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYC 326

  Fly   261 YRCGNVAAILSFETAEKRQTKIFL----AVPDAERVIPKQNTTPYFL 303
            |||||.|||:..:....||   ||    :|...|..:.:: |..|||
Yeast   327 YRCGNQAAIMEVDENHNRQ---FLQYDPSVRPGEPSVSRK-TPDYFL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 158/303 (52%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 154/287 (54%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 154/284 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.