DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and PPH22

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_010093.1 Gene:PPH22 / 851339 SGDID:S000002347 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:158/307 - (51%)
Similarity:221/307 - (71%) Gaps:8/307 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRT 65
            :..:|:|||.:.||:.|.|:::.:||:|..|:|..|.|:.|::.|||:|||:||||:||.:||:.
Yeast    75 INQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKI 139

  Fly    66 GGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSK 130
            ||..|.|||:||||:|||||||:||.:.|:.:|.|||.|||:||||||:||||:||||:|||..|
Yeast   140 GGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRK 204

  Fly   131 YGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWS 195
            ||:||.||....:||...:.|::|.::.|:||||||.|.|:||:|.::|..|:|::|..|||:||
Yeast   205 YGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEVPHEGPMCDLLWS 269

  Fly   196 DPEDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYC 260
            ||:|...||.||||||:.||.::::.|...|:|:||.||||||.||..:.....:||::||||||
Yeast   270 DPDDRGGWGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYC 334

  Fly   261 YRCGNVAAILSFETAEKRQTKIFL----AVPDAERVIPKQNTTPYFL 303
            |||||.|||:..:....||   ||    :|...|..:.:: |..|||
Yeast   335 YRCGNQAAIMEVDENHNRQ---FLQYDPSVRPGEPTVTRK-TPDYFL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 156/303 (51%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 152/287 (53%)
PPH22NP_010093.1 MPP_PP2A_PP4_PP6 78..360 CDD:277360 152/284 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.