DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:279 Identity:113/279 - (40%)
Similarity:168/279 - (60%) Gaps:5/279 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPH 71
            |..|.|  ..:||:::.||.:....:|:.|..:|.|..||.|.||||||:.||.:.|.|.|..|.
  Fly    27 WKIDRK--MMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHPPK 89

  Fly    72 TNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANG 136
            ..|:.:||:||||.||:||.|.||..|.|||:.|.|||||||:..|.:.|||:|||..:: ....
  Fly    90 KRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRF-TIRL 153

  Fly   137 WKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPEDME 201
            |:.....:|.|.:||||:.::.|.||||||.:..|:.|:.:.|..|:...|..|||:||||:...
  Fly   154 WRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDPDPTA 218

  Fly   202 Y-WGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGN 265
            . |.::.||..:.||.::.:.|::..:.:|||||||:|.:|.::....:|:||:||.|||....|
  Fly   219 IGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDN 283

  Fly   266 VAAILSFETAEKRQTKIFL 284
            ..|::..: ||...|.:.:
  Fly   284 AGAMMCVD-AELNITLVVM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 113/279 (41%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 113/279 (41%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 113/279 (41%)
PP2Ac 36..305 CDD:197547 110/268 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.